RELIABLE SOURCE AASRAWSHOP

IGF-DES

  • Specifications
  • IGF-1 DES Benefits
  • IGF-1 DES Dosing
  • Conclusion

 

Application: Analogue of insulin-like growth factor 1
CAS: 112603-35-7
Molecular Weight: 7371.4 g mol
Chemical Formula: C319H501N91O96S7
Chemical Name: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Synonyms: IGF1 Human Des1-3; Insulin-Like Growth Factor 1 Des
Storage: Minimize open air exposure, store in a cool dry place.
Stability: 2 years
Solubility: Soluble to water at rate of 1 mg/mL
Physical Form: fine powder in glass vial
Specifications: 1mg vial

 

Benefits of Insulin-like Growth Factor 1 include:

  • Increased Protein synthesis in the body
  • Fat storage is forced for energy production, which results in a noticeable fat loss.
  • Elevated recovery and repair
  • Positive effects on metabolism, increasing lean body mass and decreasing fat
  • Increase in regenerative properties of the body's nerve tissues
  • Upregulates antioxidant benefit and ligament strength
  • Boosts hyperplasia in muscle cells, which leads to fuller muscle tissues.
  • Improved cognitive function
  • Gives many anti-aging properties

 

The various researches conducted on this peptide have observed that it offers many benefits to users. The peptide provides a possible mental boost. It has given cognitive advantages in members through excitatory neurotransmitters (enabling the communication that occurs between a neuron to some other cell type in the body) of the hippocampus which is a piece of the limbic framework that includes a short-term memory and long-haul memory and spatial route. It is useful to old-aged patients, as a suitable compound to help memory issue like Alzheimer sickness.

 

IGF-1 DES has been defined as a delicate chain due to its half-life of 20-30 minutes. Its efficacy is remarkable in the specific injected area but it does not have effects on overall growth. That is why it is necessary to identify the muscle groups near to the target area of application to accomplish the best results.

The proper dose depends on whether you are a male or female.

For men, the dose tops off at 50mcg per day with the lower end being around 40mcg.

As for women, this dose is nearly cut in half in that it reduces down to 20mcg daily instead of the 40 to 50mcg for men.

 

One other thing to keep in mind is that the results may not be immediately noticeable. It may actually take a few weeks to notice the differences from the use of your IGF DES. The differences are usually noticeable around three to six months of taking it. Of course, other external factors such as age, weight, and your health history also factor in to how quickly the peptide will work as well.

 

So, although it may take some time to fully reap the benefits of the peptide, at least you'll see results that you've been waiting for. The next step is finding out where you can buy the best IGF DES so that you know it is highly effective and will get you to where you need to be. We can help with that.

 

IGF-1 DES is a truncated form of the IGF-1 protein hormone that has a higher affinity for the IGF-1 receptor than the native IGF-1 protein. It exerts its effects by activating a signaling pathway that promotes cell growth, differentiation, and survival. IGF-1 DES has a wide range of applications in medicine and sports performance, but its use in humans is currently prohibited by the WADA. Further research is needed to fully understand the potential benefits and risks of using IGF-1 DES.

Enquiry Form ( we will get back you as soon as possible )

Name:
*
Email:
*
Message:

Verification:
2 + 9 = ?

Maybe you like also

  • Buy From AASRAWSHOP

    1.Minimum order quantity: 5~10grams;5vials
    2.Lead time: Within 12 to 36 hours after payment.
    3.Delivery time: 5 to 15 working days door to door
    4.Payment method: PayPal,Bitcoin, USDT, etc.
    5.Shipping method: The safest and fastest available.
    6.Tracking number: Available after payment 12~36hours

  • About Us

    One of the Best Raw Steroid Powder Source
    100% Genuine Steroids & Sarms
    High Quality, Tested by 1st & 3rd Lab
    24/7 Professional Services
    Secure Discreet PackagingFast & Reliable ShippingGuaranteed 100% Delivery

  • Contact Us

    Email: us@aasrawshop.com
    Web: www.aasrawshop.com
    Whatsapp: +63 9054356294
    Signal: +44 7515152437
    Skype: Steroid-peptide

  • error: Content is protected !!